DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Sems

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:278 Identity:76/278 - (27%)
Similarity:115/278 - (41%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSDFQFLVTGGYRPDTN-DLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRK 102
            |..:|..|.|| |..|| .|..|.|::|       :.:|..|.||:..|..:|||||| |.:|.:
  Fly    37 PPAYQTRVIGG-RVTTNAKLGGYLVAMR-------YFNNFICGGTLIHELIVLTAAHC-FEDRAE 92

  Fly   103 LKAKKLMVVAGTPRRL----LKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAV 163
               |:...|.|...||    ::....:.|::.:.       |..:...|:.::||...: :|..:
  Fly    93 ---KEAWSVDGGISRLSEKGIRRQVKRFIKSAQF-------KMVTMNMDVAVVLLNRPM-VGKNI 146

  Fly   164 AKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPD----------------------EAINGDMQILP 206
            ..:.|.:.....|....:.|||..     .||                      ||....:.|..
  Fly   147 GTLSLCSTALTPGQTMDVSGWGMT-----NPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISD 206

  Fly   207 DTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDV 271
            ..||..:||               ..|:|..||||||:.:..|.||||||:||......|:||||
  Fly   207 SMFCASVLG---------------KKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDV 256

  Fly   272 YHFRDWITENSCPLGTRS 289
            ::.:.:|.:....|.:||
  Fly   257 HYVKPFIVKGIKALLSRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/246 (26%)
Tryp_SPc 60..278 CDD:214473 63/243 (26%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/259 (27%)
Tryp_SPc 44..265 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.