DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32374

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:213 Identity:59/213 - (27%)
Similarity:98/213 - (46%) Gaps:23/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNHF-CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKY 138
            :|:| |...|.:.|.||||.||...|     ..:..|.||:.:   :....|:...::.:.||.|
  Fly    94 NNYFICGCVILNRRWILTAQHCKIGN-----PGRYTVRAGSTQ---QRRGGQLRHVQKTVCHPNY 150

  Fly   139 KKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIV-GWGTVIQFGPLPDEAINGDM 202
            .: .:.|.|:.::.|:..|::|..|.|:.|.:........|.:. |||............:.|.:
  Fly   151 SE-YTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVI 214

  Fly   203 QI-LPDTFCEKLLGWSNAG------MLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCG 260
            .. :....|::  .:...|      |:||..|:.   |:|.|||||||:.:.::.||.|||:||.
  Fly   215 VCKVSRAKCQQ--DYRGTGIKIYKQMICAKRKNR---DTCSGDSGGPLVHNGVLYGITSFGIGCA 274

  Fly   261 EPDSAGIYTDVYHFRDWI 278
            .....|:|.:|..:..||
  Fly   275 SAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 59/213 (28%)
Tryp_SPc 60..278 CDD:214473 57/211 (27%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 57/211 (27%)
Tryp_SPc 74..295 CDD:238113 59/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.