DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG10469

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:224 Identity:67/224 - (29%)
Similarity:100/224 - (44%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQ--IIEAEELLPHPKYK 139
            :.|.|||.|.|.|:|||||:...:..|  .|:::..|.    :||...:  ::.....:.|.|:.
  Fly    53 NMCGGTILSNRWIITAAHCLQDPKSNL--WKVLIHVGK----VKSFDDKEIVVNRSYTIVHKKFD 111

  Fly   140 KGKSQKYDIGLILLEADLSLGDAV--AKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAING-D 201
            : |:...||.||.|...|:....:  ||:|...|. ..|....|.|||...:  .||.:.:.. .
  Fly   112 R-KTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKT-YTGRKAIISGWGLTTK--QLPSQVLQYIR 172

  Fly   202 MQILPDTFCE----KLLGWSNA-----GMLCANDKHDSDVDSCQGDSGGPLICDN---MVTGIVS 254
            ..|:.:..||    |.||..:.     |.:|.:.|...   .|:||||||::.|:   .:.||||
  Fly   173 APIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL---PCRGDSGGPMVLDDGSRTLVGIVS 234

  Fly   255 FGMGCGE-----PDSAGIYTDVYHFRDWI 278
            .|.. ||     ||   :.|.|..:..||
  Fly   235 HGFD-GECKLKLPD---VSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/224 (30%)
Tryp_SPc 60..278 CDD:214473 65/222 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/222 (29%)
Tryp_SPc 24..260 CDD:238113 67/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.