DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG3650

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:109/252 - (43%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 APSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHC 95
            |..|.|.|       :.||.....:.:..:.|:||       :....:|.|::.:...::|||||
  Fly    18 ASGQIQPR-------IVGGTTTTLSAVGGFVVNLR-------YDGTFYCGGSLVTSSHVVTAAHC 68

  Fly    96 MFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLG 160
            :    :..:|.::.|..|    :.|.|.:.::........|......|..:|:|:|.|::.|: |
  Fly    69 L----KGYQASRITVQGG----VSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALT-G 124

  Fly   161 DAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAING-DMQILPDTFCEKLLGWSN---AGM 221
            ..:..|||.......|....:.||||.......|...:.. .:|::....|::.....:   |..
  Fly   125 SGITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTAST 189

  Fly   222 LCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278
            .||   .....|||.|||||.:|..|.:.||||:|:||......|:||.|:..|.:|
  Fly   190 FCA---RTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 60/223 (27%)
Tryp_SPc 60..278 CDD:214473 59/221 (27%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 62/243 (26%)
Tryp_SPc 26..243 CDD:238113 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.