DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG9897

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:234 Identity:59/234 - (25%)
Similarity:91/234 - (38%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKS 143
            |.|.|.|:..|||||.|:..    ..|:.:.|..||.......|...|.:.:   .|.:|   .|
  Fly    48 CGGAIISKNYILTAAKCVDG----YSARSIQVRLGTSSCGTSGSIAGICKVK---VHSQY---SS 102

  Fly   144 QKYDIGLILLEAD--LSLGDAVAKIPLYNKVPVAGAPCSIVGWG------------TVIQFG--- 191
            .::|..|.||:..  |:..|.:..|...:|||...:..::.|.|            ..|..|   
  Fly   103 WRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEE 167

  Fly   192 ---PLPDEAINGDMQILPDTFCEK---------LLGWSNAGMLCANDKHDSDVDSCQGDSGGPLI 244
               .||.:.....::||....|..         |.|.|:. .:|.......   :|..|.|.||:
  Fly   168 KCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDL-TICTKSPGKG---ACSTDRGSPLV 228

  Fly   245 CDNMVTGIVSFGMGCG-EPDSAGIYTDVYHFRDWITENS 282
            .||.:.||:| ..||. :||   :|.::....:|:..|:
  Fly   229 IDNKLVGILS-RAGCSIKPD---VYANILGHTNWLDSNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 58/231 (25%)
Tryp_SPc 60..278 CDD:214473 57/228 (25%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 57/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.