DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32833

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:290 Identity:64/290 - (22%)
Similarity:122/290 - (42%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGD 75
            :.:::...|.|::.||:     ...:|..:|......||: |.......:..|:.:.:..|    
  Fly     8 IFLALFVLSKSDTGAGE-----DSEEDDENDCNRTTLGGH-PVNITTAPWIASISIKQKAK---- 62

  Fly    76 NHFCAGTIFSERAILTAAHCM--FSNRRKLKAKKLMVVAGTPRRLLKSSTTQ---IIEAE--ELL 133
               |.|.|:....|:||..|:  |.|:         |:     |:...|||:   :||..  .:.
  Fly    63 ---CDGAIYKLSHIVTAGKCVDGFLNK---------VI-----RVRVGSTTRSDGVIEVAVCNIT 110

  Fly   134 PHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGP-----L 193
            .|.|: .|::..:::.::.|...|.....:..|.|.|::|..||..:..||.:...:..     |
  Fly   111 VHEKF-TGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKKCL 174

  Fly   194 PDEAI---NGDMQILPDTFCEKLL---GWSNAGM---LCANDKHDSDVDSCQGDSGGPLICDNMV 249
            .|||.   ..::::|..:.|..|.   .||....   |...:|...  ::|....|.|::.:..:
  Fly   175 DDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAK--EACSLAMGSPVVHNGKL 237

  Fly   250 TGIVSFGMGCGE-PDSAGIYTDVYHFRDWI 278
            .||::.| ||.| |:   :|.::..::||:
  Fly   238 VGIITKG-GCSEYPE---VYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 55/241 (23%)
Tryp_SPc 60..278 CDD:214473 54/239 (23%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 58/253 (23%)
Tryp_SPc 40..262 CDD:214473 56/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.