DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Ser8

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:123/275 - (44%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LISVSANSNSESQAGQL-HSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSL-RMGKPKKFFG 74
            :|.:.....:.|..|:: ....|..:|||                    :.||| |.|       
  Fly    19 VIPIGLEPQTSSLGGRIVGGTASSIEDRP--------------------WQVSLQRSG------- 56

  Fly    75 DNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYK 139
             :|||.|:|.|...|:|||||:.:   ......|.:.||:.:|....   .::|...:..|..| 
  Fly    57 -SHFCGGSIISNNIIVTAAHCLDT---PTTVSNLRIRAGSNKRTYGG---VLVEVAAIKAHEAY- 113

  Fly   140 KGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQI 204
            ...|:..|||::.|:..|:.|..:..|.:.:..|..|:..||.|||.....||.....:..|.:|
  Fly   114 NSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRI 178

  Fly   205 LPDTFC-EKLLGWSN---AGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSA 265
            :..:.| ....|:.:   |.|:||   ..::.|:|||||||||:....:.|:||:|..|...:..
  Fly   179 VGRSQCGSSTYGYGSFIKATMICA---AATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYP 240

  Fly   266 GIYTDVYHFRDWITE 280
            |:|.::...|||:.:
  Fly   241 GVYANIAELRDWVLQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/226 (31%)
Tryp_SPc 60..278 CDD:214473 68/222 (31%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/256 (28%)
Tryp_SPc 35..253 CDD:238113 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.