DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG13744

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:306 Identity:78/306 - (25%)
Similarity:113/306 - (36%) Gaps:80/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHSAPSQRQDRPSDFQFLVT-----GGYRPDTNDLVKYTVSLRMGKPKKFFG---------DNHF 78
            |:|.|.:...|..|...|:.     |..|...|.|.|..:.   |:|.:|..         ..:.
  Fly   104 LNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIG---GRPAQFAEYPWQAHIRIAEYQ 165

  Fly    79 CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLP--------- 134
            |.|.:.|...:.|||||:    ::.....:.|..|      :..|..:....|.||         
  Fly   166 CGGVLISANMVATAAHCI----QQAHLADITVYLG------ELDTQDLGHIHEPLPVEKHGVLQK 220

  Fly   135 --HPKYKKGKSQ--KYDIGLILLEADLSLGDAVAKI--PLYNKVPVAGAPCSIVGWG-------- 185
              ||::....:|  :|||.|:.|....|..:.:..|  |.| .:.:.|....|.|||        
  Fly   221 IIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQY-PIRLIGRKGLIAGWGKTEAHMGH 284

  Fly   186 ---TVIQFGPLPDEAINGDMQILPDTFCEKLLGWS---------NAGMLCANDKHDSDVDSCQGD 238
               .::|...:|         |:....|   :.|.         .|.|.||... |..:|:|.||
  Fly   285 AGTNMLQVASVP---------IITTLDC---IRWHESKQINVEIKAEMFCAGHS-DGHMDACLGD 336

  Fly   239 SGGPLICDN----MVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITE 280
            |||||:...    ::.||.|.|.|||.....|||.:|.....||.|
  Fly   337 SGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/269 (25%)
Tryp_SPc 60..278 CDD:214473 64/265 (24%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 64/265 (24%)
Tryp_SPc 142..383 CDD:238113 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.