DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Send2

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:126/273 - (46%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSL-RMGKPKKF 72
            ::||:::::.|     ||.: ..|.:|          :.|| :|...:...:.||: |.||    
  Fly     6 FLLLLALNSLS-----AGPV-IRPEER----------IIGG-QPIGIEEAPWQVSIQRDGK---- 49

  Fly    73 FGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPK 137
                |.|.|:|:|...|:|||||       ::.:...|.||:   .||:|...:::...:..|  
  Fly    50 ----HLCGGSIYSADIIITAAHC-------VQGQGYQVRAGS---ALKNSNGSVVDVAAIRTH-- 98

  Fly   138 YKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFG-PLPDEAINGD 201
              :|...  ||.::.|...|...:.|..|||....|..|:...:.|||:...:. |:..:.:|  
  Fly    99 --EGLGN--DIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPIDLQGVN-- 157

  Fly   202 MQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFG-MGCGEPDSA 265
            :.|....:|    |.:....:||.....:   :|:|||||||:.|..:.|:||.| ..|   ..:
  Fly   158 LYIQWPYYC----GLTEPSRICAGSFGRA---ACKGDSGGPLVFDQQLVGVVSGGTKDC---TYS 212

  Fly   266 GIYTDVYHFRDWI 278
            .|||.|.:||:||
  Fly   213 SIYTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 66/222 (30%)
Tryp_SPc 60..278 CDD:214473 64/220 (29%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 68/245 (28%)
Tryp_SPc 27..225 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.