DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Phae2

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:295 Identity:85/295 - (28%)
Similarity:126/295 - (42%) Gaps:65/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFG 74
            |||::|..:..|    |.....|..|          |.||.....|. ..|.||::       :|
  Fly    10 ILLLAVCVSQGS----GLALDQPEGR----------VVGGKAAAANS-APYIVSMQ-------YG 52

  Fly    75 DNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKL----MVVAGTPRRLLKSSTTQIIEAEELLPH 135
            ..|:||..|.:...::|||||: :||.::....|    :.||||      :||||..:....:.:
  Fly    53 GTHYCAANIINSNWLVTAAHCL-ANRNQVLGSTLVAGSIAVAGT------ASTTQKRQITHYVIN 110

  Fly   136 PKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAG----APCSIVGWGTVIQ-----FG 191
            ..| .|.:..||||||......:...|||.:    |:|.:|    ....:.|||:..:     :.
  Fly   111 DLY-TGGTVPYDIGLIYTPTAFTWTAAVAPV----KLPSSGVRPTGKADLFGWGSTSKTNSPSYP 170

  Fly   192 PLPDEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDV---------DSCQGDSGGPLICDN 247
            ....||.|  :.|:....|...||..      ..|.|.:::         ..|..||||||:..|
  Fly   171 KTLQEAKN--IPIISLDSCAAALGSK------GQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGN 227

  Fly   248 MVTGIVSFG-MGCGEPDSAGIYTDVYHFRDWITEN 281
            ::.||||:| :.||:|:|..:|..|..|..||..|
  Fly   228 VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 72/243 (30%)
Tryp_SPc 60..278 CDD:214473 70/240 (29%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/265 (28%)
Tryp_SPc 32..262 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.