DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Phae1

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:124/288 - (43%) Gaps:53/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFG 74
            :||:.:...|      |....||..|          |.|| .|...:...|.||::       :|
  Fly    16 LLLLGICRIS------GVAIGAPEGR----------VVGG-SPAAVNSAPYAVSMQ-------YG 56

  Fly    75 DNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKL---MVVAGTPRRLLKSSTTQIIEAEELLPHP 136
            ..|:||.:|.:...::|||||:.::.:.|.:..:   :.|.||      :||||.......:.:.
  Fly    57 GTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT------ASTTQTRSITYFVIND 115

  Fly   137 KYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWG--TVIQFGPLPDE-AI 198
            .| .|.:..||||:|..........|||.:.|.:...|.....::.|||  :.......|.. .:
  Fly   116 LY-TGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQV 179

  Fly   199 NGDMQILPDTFCEKLLGWSNAGMLCANDKHDSD---------VDSCQGDSGGPLICDNMVTGIVS 254
            ..::.|:..:.||..||..      .:|.|.::         |..|..||||||:..|::.||||
  Fly   180 ATNVPIISLSSCESALGTK------GSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVS 238

  Fly   255 FG-MGCGEPDSAGIYTDVYHFRDWITEN 281
            :| :.||:.:|..:|..|..|..||:.|
  Fly   239 WGKLPCGQANSPSVYVQVSSFISWISAN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 66/236 (28%)
Tryp_SPc 60..278 CDD:214473 64/233 (27%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 69/258 (27%)
Tryp_SPc 36..266 CDD:238113 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.