DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Try29F

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:293 Identity:80/293 - (27%)
Similarity:127/293 - (43%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPK 70
            |:..|||:::|..:...               ||. ....:.||...:..| :.|.|||:.    
  Fly    18 FIGGILLVNLSLGATVR---------------RPR-LDGRIVGGQVANIKD-IPYQVSLQR---- 61

  Fly    71 KFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPH 135
                ..|||.|::.::..:||||||...:...|...::    |:.|   .|...|::..:.:..|
  Fly    62 ----SYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRI----GSSR---TSVGGQLVGIKRVHRH 115

  Fly   136 PKYKKGKSQKYDIGLILLE--ADLSLGDAVAKIPLYNKVPVAGAPCSIVGWG---------TVIQ 189
            ||: ...:..:|..|:.||  :..::..|...:|..:.....|.|..:.|||         .|::
  Fly   116 PKF-DAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLR 179

  Fly   190 FGPLPDEAINGDMQILPDTFCEKLLGWSNAG-----MLCANDKHDSDVDSCQGDSGGPLICDNMV 249
            ...:|.         :..|.|.:..|  |.|     ||||. ..:...|:|||||||||..|.::
  Fly   180 SVTVPK---------VSQTQCTEAYG--NFGSITDRMLCAG-LPEGGKDACQGDSGGPLAADGVL 232

  Fly   250 TGIVSFGMGCGEPDSAGIYTDVYHFRDWITENS 282
            .|:||:|.||..|:..|:|:.|...||||:..|
  Fly   233 WGVVSWGYGCARPNYPGVYSRVSAVRDWISSVS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/236 (29%)
Tryp_SPc 60..278 CDD:214473 67/233 (29%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 70/248 (28%)
Tryp_SPc 42..264 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.