DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Ser12

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:112/272 - (41%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFG 74
            :|:.||:..|     ||   |:|.:           :.||: |.....|.:..:|       .:.
  Fly     7 VLVASVTLIS-----AG---SSPER-----------IVGGH-PVLISEVPWQAAL-------MYS 44

  Fly    75 DNHFCAGTIFSERAILTAAHCM---FSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHP 136
            :.:.|...|:|::.|:|||||:   |.....::...:.          |:...|......:..|.
  Fly    45 EKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVW----------KNLGGQHARVAVIRKHE 99

  Fly   137 KYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGD 201
            .|........||.:|.|...|.....|..|.|.:..|.||...|:.|||.:......|...:...
  Fly   100 DYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTS 164

  Fly   202 MQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAG 266
            ::||....|::...:....|:||.....   |||.|||||||:....:.||||:|:||..|...|
  Fly   165 VKILDPNVCKRSYQYITKTMICAAALLK---DSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPG 226

  Fly   267 IYTDVYHFRDWI 278
            :|.:|...:.||
  Fly   227 VYANVAELKPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 60/222 (27%)
Tryp_SPc 60..278 CDD:214473 58/220 (26%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 62/246 (25%)
Tryp_SPc 24..238 CDD:238113 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.