DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Ser6

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:299 Identity:85/299 - (28%)
Similarity:133/299 - (44%) Gaps:68/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCPSKFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVK----YT 61
            :|  .|:::::|              .:.|||.:...|       |.||     .|.||    :.
  Fly    10 LC--SFLLFLVL--------------PVQSAPGKLNGR-------VVGG-----EDAVKNQFPHQ 46

  Fly    62 VSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNR------RKLKAKKLMVVAGTPRRLLK 120
            ||||.       ..:|.|.|:|.:...|||||||: ||.      ..:.|::..:.||:..|.  
  Fly    47 VSLRN-------AGSHSCGGSILTRTYILTAAHCV-SNEDVNHVITPIAAERFTIRAGSNDRF-- 101

  Fly   121 SSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCS----I 181
             |...:::..|::.|.:|....:   |:.|:.||:.|.|..::..|.|    |....|..    |
  Fly   102 -SGGVLVQVAEVIVHEEYGNFLN---DVALLRLESPLILSASIQPIDL----PTVDTPADVDVVI 158

  Fly   182 VGWGTVIQFGPLPDEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICD 246
            .|||.:...|.||.......::.:....||:|:.:...|.||.  .|..|..:|.||||||.:.:
  Fly   159 SGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCL--LHQVDNGACNGDSGGPAVYN 221

  Fly   247 NMVTGIVSFGM-GCGE--PDSAGIYTDVYHFRDWITENS 282
            |.:.|:..|.: |||.  ||.   |..|::|:|||.::|
  Fly   222 NQLVGVAGFVVDGCGSTYPDG---YARVFYFKDWIKKHS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 71/233 (30%)
Tryp_SPc 60..278 CDD:214473 69/230 (30%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/256 (30%)
Tryp_SPc 32..256 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.