DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and sphe

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:117/292 - (40%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKK 71
            :|.:.||.::|       .|..|:            |..:.||...|.. ...:|.|||:     
  Fly     6 LVILGLIGLTA-------VGMCHA------------QGRIMGGEDADAT-ATTFTASLRV----- 45

  Fly    72 FFGDN-HFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQ-----IIEAE 130
               || |.|.|:|.|:..|||.|||:..:.:.:.|.:|....|        ||.|     |:..|
  Fly    46 ---DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG--------STNQYAGGKIVNVE 99

  Fly   131 ELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLY---NKVPVAGAPCSIVGWGTVIQFGP 192
            .:..||.|   .:...::.:|.|.::|:..|.:..|||.   ..:|..|:...:.|||..     
  Fly   100 SVAVHPDY---YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRT----- 156

  Fly   193 LPDEAING------DMQILPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTG 251
              .:..|.      .:::.|:..|.......:....|.  .|:....:|.||.||..|..|.:.|
  Fly   157 --SDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCL--AHELKEGTCHGDGGGGAIYGNTLIG 217

  Fly   252 IVSFGMG-CGE--PDSAGIYTDVYHFRDWITE 280
            :.:|.:| ||.  ||   ::..:..:.|||.|
  Fly   218 LTNFVVGACGSRYPD---VFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 63/239 (26%)
Tryp_SPc 60..278 CDD:214473 60/235 (26%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/236 (26%)
Tryp_SPc 42..244 CDD:214473 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.