DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG33160

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:302 Identity:79/302 - (26%)
Similarity:119/302 - (39%) Gaps:88/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKFVVYILLISVSANSNSESQAGQLHSA----PSQRQDRPSDFQFLVTGGYRPDTND---LVKYT 61
            |.|:|.||               ..|||    |...|.:|.     :.||:.....:   ||:.|
  Fly     8 SLFLVQIL---------------GFHSAVYAHPDSVQIQPR-----IIGGHVSSIKEEKYLVQVT 52

  Fly    62 VSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGT-----PRRLLKS 121
            .|            ...|.|::...|.::|||||:: |:.|...|   :..|.     |..::::
  Fly    53 TS------------EELCGGSLVKPRWVITAAHCVY-NKNKNDFK---IYGGASNQAGPYAVIRT 101

  Fly   122 STTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGT 186
                   .:.:...|.:.: |:...|:..:.|.:|: :|..:..|||..:...|.|...:.|||.
  Fly   102 -------VDYIAIRPDFNR-KTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARALVKVSGWGF 157

  Fly   187 VIQFGPLPDEAINGDMQILPDTFCEKLLGWSNA--------------GMLCANDKHDSDVDSCQG 237
            :........|.::..:..:          ||.|              .|:||...:..  |||.|
  Fly   158 LTADATKTAERVHSVLVPM----------WSRASCVSAFRGIHRITRSMVCAARLYKK--DSCDG 210

  Fly   238 DSGGPLICDNMVTGIVSFGMGCGEPDSA--GIYTDVYHFRDW 277
            ||||||:....:.||||||.||.   ||  ||||.|...|||
  Fly   211 DSGGPLVYRGQLAGIVSFGYGCA---SALPGIYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/239 (27%)
Tryp_SPc 60..278 CDD:214473 64/239 (27%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/260 (25%)
Tryp_SPc 34..253 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.