DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG33159

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:237 Identity:74/237 - (31%)
Similarity:106/237 - (44%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHF-CAGTIFSERAILTAAHCMFSNRRKLKAKKLM 109
            :.|| :..|...|.|.|.||.        :.:| |.|::.|.||:|:||||::.:    :.:...
  Fly    26 IVGG-KETTISEVPYLVYLRQ--------NGYFICGGSLISSRAVLSAAHCVYGS----QPEGFT 77

  Fly   110 VVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEAD----LSLGDAVAKIPLYN 170
            |.||..|  |......:.........|.|   .:..:|:.:.||:..    |:.|......|..|
  Fly    78 VHAGASR--LDQEAPVVRNVVMFHTSPSY---SATNFDMDVALLQLQEVVVLTPGKVATISPCRN 137

  Fly   171 KVPVAGAPCSIVGWGTVIQFGPLPDEAINGDM-QILPDTFCEKLLGWSNAG-----MLCANDKHD 229
            . |...|...|.|||...:....|.|.:...| ::||...|:  :.:|..|     ||||..:  
  Fly   138 P-PEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECK--ISYSGYGQLSDSMLCAAVR-- 197

  Fly   230 SDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDV 271
            ...|||.|||||||:....|.||||:|.||..|...|:||:|
  Fly   198 GLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 70/223 (31%)
Tryp_SPc 60..278 CDD:214473 70/223 (31%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 74/237 (31%)
Tryp_SPc 26..251 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.