DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG31681

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:278 Identity:95/278 - (34%)
Similarity:136/278 - (48%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGD 75
            ||:|:..:....:.|.:: ..|.:|         :|.|.|.|  .:.|.:.||::         :
  Fly     5 LLLSILVSIAGLACAARI-PGPEER---------IVGGSYIP--IEYVPWQVSVQ---------N 48

  Fly    76 N--HFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKY 138
            |  |.|.|.|:|:|||||||||: ||   :....|.|.||:.   ..|...|:::..:.:.||||
  Fly    49 NSLHCCGGVIYSDRAILTAAHCL-SN---VTVTDLSVRAGSS---YWSKGGQVLKVLKTIAHPKY 106

  Fly   139 KKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAING-DM 202
            .......|||.:::|||.|.||..|.||||..:.||||......|||...:........:.| .:
  Fly   107 VPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHV 171

  Fly   203 QILPDTFCEKLLGWSN--AGMLCANDKHDSDVDSCQGDSGGPLI-----CDNMVTGIVSFGMGCG 260
            .||..|.|.|.....|  ..|:||:.:.   .|:||||||||||     ....:.|:||:|.|||
  Fly   172 AILNRTDCLKAYKHVNITIDMICADGQR---WDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG 233

  Fly   261 EPDSAGIYTDVYHFRDWI 278
              .:.|:|.|:..|.:||
  Fly   234 --TNPGVYEDIAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 84/229 (37%)
Tryp_SPc 60..278 CDD:214473 82/227 (36%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 88/252 (35%)
Tryp_SPc 29..250 CDD:238113 89/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.