DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32834

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:108/262 - (41%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKA 105
            |.|..:.|||..|..| ..|...:       .......|:|.|.:...|:|||.|:.|      .
  Fly    22 DAQSRIIGGYDVDIED-APYQAEV-------IIDGTAICSGAIITSDTIITAASCVQS------Y 72

  Fly   106 KKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEA--DLSLGDAVAKIPL 168
            ..:.|..||..|.. ..|..::|..|::.||:|   ...::|..|.||:.  .|...:|:..|.:
  Fly    73 GSIEVRVGTSSRDY-DGTGFLLEVCEIINHPQY---NCWRFDNNLALLKLCDPLKTSEAIQPISI 133

  Fly   169 YNKVPVAGAPCSIVGWGTVIQ--------FGPLPDEAINGDMQILPDTFCEKLLG-----WSNAG 220
            ....|..|:.|::.|||:...        ||.|||......:.:.....|....|     |.| |
  Fly   134 AEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDN-G 197

  Fly   221 M----LCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGC-GEPDSAGIYTDVYHFRDWITE 280
            :    ||.:    :....|..|:|.||:.|..:.||:|.| || .:||   :|.:|..|..||.|
  Fly   198 ISYLTLCTH----NGAGGCSYDTGAPLVIDGQLVGILSEG-GCTTKPD---VYANVPWFTGWIAE 254

  Fly   281 NS 282
            |:
  Fly   255 NT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/240 (27%)
Tryp_SPc 60..278 CDD:214473 62/237 (26%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 67/252 (27%)
Tryp_SPc 27..255 CDD:238113 69/254 (27%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.