DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32808

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:113/264 - (42%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKL 103
            |.:|.|:                ||||..|     ...|.|..|:.:...:||||||:    |..
  Fly    38 PGEFPFV----------------VSLRRAK-----SGRHSCGATLLNPYWVLTAAHCV----RGS 77

  Fly   104 KAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAV--AKI 166
            ..::|.:..|:  ::|..:::|:.....:..||.|:.......||.|:.|...::|...|  .::
  Fly    78 SPEQLDLQYGS--QMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRL 140

  Fly   167 PLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFC-EKLLGWSNAGMLCANDKHDS 230
            |...:|....|...:.|||.....|.:........:|:..||.| |:...:.:...:||. ..:.
  Fly   141 PEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAG-LPEG 204

  Fly   231 DVDSCQGDSGGPLI---CDNMVTGIVSFGM-GCGEPDSAGIYTDVYHFRDWITEN----SCPLGT 287
            ....|.|||||||:   .|..| ||||:.: .|..|...|::|:|..:.|||.|.    |.|   
  Fly   205 GKGQCSGDSGGPLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPP--- 265

  Fly   288 RSVW 291
            .|:|
  Fly   266 SSLW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/227 (28%)
Tryp_SPc 60..278 CDD:214473 62/224 (28%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 65/245 (27%)
Tryp_SPc 30..258 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.