DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32523

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:115/295 - (38%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKK 71
            |:.:||..|......:....|..||...|          :.||.:...... .:.:|||:     
  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPR----------IVGGIKAKQGQF-PHQISLRL----- 56

  Fly    72 FFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHP 136
              ...|:|.|.|.|...::||.||:......:.|....:.||:   ||.||....|...|::.||
  Fly    57 --RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS---LLLSSDGVRIPVAEVIMHP 116

  Fly   137 KYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGD 201
            .|..|...  |:.::.|::.|:....:|.|.|..:.|.......|.|||.:.:.|||.|..:  .
  Fly   117 NYATGGHN--DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLL--F 177

  Fly   202 MQI---------------LPDTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTG 251
            :|:               ||:|            |:|.  .|..:..:|.||||||......|.|
  Fly   178 VQVTSISRGACRWMFYSRLPET------------MICL--LHSKNSGACYGDSGGPATYGGKVVG 228

  Fly   252 IVS--FGMGCGE--PDSAGIYTDVYHFRDWITENS 282
            :.|  .|.|||.  ||.   |..:...|.||.|.:
  Fly   229 LASLLLGGGCGRAAPDG---YLRISKVRAWIAEKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/239 (28%)
Tryp_SPc 60..278 CDD:214473 65/236 (28%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/261 (26%)
Tryp_SPc 37..219 CDD:238113 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.