DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG32376

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:232 Identity:58/232 - (25%)
Similarity:98/232 - (42%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FFGDNHF-----CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEE 131
            |.|..|:     |...|.::..||||.||.|.     ..:|..|..|:.::........:.:...
  Fly    79 FQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-----PPEKYTVRVGSDQQRRGGQLRHVKKIVA 138

  Fly   132 LLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPL----YNKVPVAGAPCSIVGWGTVIQFGP 192
            |..:..|    :.::|:.::.|::.:..|..|..:.|    ..|.|   ....:.|||..     
  Fly   139 LAAYNDY----TMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFP---KKFVVSGWGIT----- 191

  Fly   193 LPDEAINGD--------MQI--LPDTFCEKLLGWSNAG------MLCANDKHDSDVDSCQGDSGG 241
                :.|..        :||  :..:.|:|:  :..||      |:||:   .::.|||.|||||
  Fly   192 ----SANAQNVQRYLRRVQIDYIKRSKCQKM--YKKAGLKIYKDMICAS---RTNKDSCSGDSGG 247

  Fly   242 PLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278
            ||....::.||||:|:||...:..|:|.:...:..||
  Fly   248 PLTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 58/232 (25%)
Tryp_SPc 60..278 CDD:214473 56/230 (24%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 56/230 (24%)
Tryp_SPc 66..287 CDD:238113 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.