DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG6041

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:294 Identity:90/294 - (30%)
Similarity:142/294 - (48%) Gaps:24/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GQLHSAPSQRQDRPSDFQFLVTGGYRPDTN-DLVKYTVSLRM-GKPKKFFGDNHFCAGTIFSERA 88
            |.|.|..|...:.....:..:.|||  |.: :.|.|.||:|: ...||.:|..|.|.|.:.|:|.
  Fly    15 GALASGESLSSETAGKIEPKIVGGY--DASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRL 77

  Fly    89 ILTAAHCMF-SNRRKLK-AKKLMVVAGTPRRLLKSST--TQIIEAEELLPHPKYKKGKSQKYDIG 149
            :.|||||.: ::::|.: |.:.::|.|:  ..|.|||  |.:...::|:.|..|.. .:...||.
  Fly    78 VATAAHCCYITDKKKYRTAGEFVLVMGS--TYLTSSTDRTLMYYLQQLITHENYNP-DALTNDIA 139

  Fly   150 LILLEADLSLG-DAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAIN-GDMQILPDTFCEK 212
            |:.:...:... ..|..:.|.:::......|.|.|||.:.|.|......:. ..:.|:..|.|..
  Fly   140 LMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRI 204

  Fly   213 LLGWSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDW 277
            .........:||. .....||:||||||||:.|:.|:.||||:|.||..|...|:||:|.::.||
  Fly   205 SYNSIPVSQVCAG-YLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDW 268

  Fly   278 ITENSCPL--------GTR--SVWTLFLLLLLLL 301
            |.:.:..|        |.|  |.|:...:|.||:
  Fly   269 IVQKNSSLNYTIYHNGGVRQGSSWSYLGILPLLV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 73/227 (32%)
Tryp_SPc 60..278 CDD:214473 71/224 (32%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/240 (32%)
Tryp_SPc 35..272 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.