DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG14780

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:306 Identity:89/306 - (29%)
Similarity:147/306 - (48%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPK 70
            ::::..|::.:|....|:|..::.:....:.|.                   .::.||:|:.:..
  Fly    11 YILFWFLLACAAADLQENQQSRIINGSVAKADE-------------------TRHLVSIRLLRHD 56

  Fly    71 KFFGDNHFCAGTIFSERAILTAAHCMFSNRRK--LKAKKLMVVAGTPRRLLKSSTTQIIEAEELL 133
            ..||..|.|.|.:.:.|.:||||||:::|:||  .:|.:.:||.||..|....:.| |:.....:
  Fly    57 NNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGT-IVSQVSSM 120

  Fly   134 PHPKYKKGKSQKYDIGLILLEADLSLGD------AVAKIPLYNKVPVAGAPCSIVGWGTVIQFGP 192
            .:.......|.:.|:|::.|...|.:..      .||.|.|..::...|..|.:.|||...| ..
  Fly   121 AYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQ-SS 184

  Fly   193 LPDEAINGDMQILPDTFCEKLLGWSN--AGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSF 255
            |.:..:..::..:....| :::..|.  .||:||. :.....|||||||||||:.:..:.|:||:
  Fly   185 LSNILLTANVSTIRHQTC-RMIYRSGLLPGMMCAG-RLQGGTDSCQGDSGGPLVHEGRLVGVVSW 247

  Fly   256 GMGCGEPDSAGIYTDVYHFRDWITENSCPLGTRSVWTLFLLLLLLL 301
            |.||.||...|:|.||.::|.||...|....:|....|||||||.|
  Fly   248 GYGCAEPGLPGVYVDVEYYRQWIEGRSGAPHSRLATGLFLLLLLPL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 74/230 (32%)
Tryp_SPc 60..278 CDD:214473 72/227 (32%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 73/260 (28%)
Tryp_SPc 33..271 CDD:238113 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.