DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and PRSS55

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:250 Identity:79/250 - (31%)
Similarity:123/250 - (49%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VTGGYRPDTNDLVKYTVSLR-MGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLM 109
            :|||...:..:. .:.||:: ..:|        ||.|:|.::..|||||||::|  .:|..::|.
Human    68 ITGGMEAEVGEF-PWQVSIQARSEP--------FCGGSILNKWWILTAAHCLYS--EELFPEELS 121

  Fly   110 VVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPV 174
            ||.||  ..|.|.:.:|.|...::.|..:|:..... ||.|:||.:.:.|.|  .|:|:.  :|.
Human   122 VVLGT--NDLTSPSMEIKEVASIILHKDFKRANMDN-DIALLLLASPIKLDD--LKVPIC--LPT 179

  Fly   175 AGAP-----CSIVGWGTVIQFGPLPDEAINGDMQILPDTF-----CEKLLGWSNAGMLCANDKHD 229
            ...|     |.:.|||   |.......::..|:...|...     |.|:.......||||..|::
Human   180 QPGPATWRECWVAGWG---QTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYKNE 241

  Fly   230 SDVDSCQGDSGGPLICDN------MVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278
            | .|:|:|||||||:|..      ...||:|:|..|||.::.||||.:.::..||
Human   242 S-YDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 75/235 (32%)
Tryp_SPc 60..278 CDD:214473 74/234 (32%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 77/248 (31%)
Tryp_SPc 68..298 CDD:238113 78/249 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.