DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and LOC100495541

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:251 Identity:67/251 - (26%)
Similarity:103/251 - (41%) Gaps:64/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NHFCAGTIFSERAILTAAHCMFSNRR------KLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLP 134
            :|.|.|::.:.:.|:|||||...::.      :|.|.:|.::  :|..:..:..:.|:.:     
 Frog   384 SHICGGSLIATQWIMTAAHCFEYSKSPSDYKIRLGAYQLSLI--SPHEITSTVDSIIVNS----- 441

  Fly   135 HPKYKKGKSQKYDIGLILLEADLSLGDAVAKI--PLYNKVPVAGAPCSIVGWGTVIQFGPLP--- 194
                ....|...||.||.|.:.::....:..|  |..:.....|..|.:.||||:.....||   
 Frog   442 ----PNSSSTNTDIALIRLTSPITYTKYILPICLPSTSDGFTEGMECWVTGWGTIASQVNLPYPM 502

  Fly   195 ---------------DEAINGD---MQILP-DTFCEKLLGWSNAGMLCANDKHDSDVDSCQGDSG 240
                           ::..|.|   ..::| |..|        || ..|..|     ||||||||
 Frog   503 TLQQVMTPLISRATCNQMYNTDSLLSVVVPLDQIC--------AG-YAAGQK-----DSCQGDSG 553

  Fly   241 GPLICDNM----VTGIVSFGMGCGEPDSAGIYTDVYHFRDWI-----TENSCPLGT 287
            |||:|...    ..||||:|.||...:..|:||.|..:..|:     |.|...:||
 Frog   554 GPLVCQLQGIWYQIGIVSWGEGCAVRNRPGVYTLVPAYYSWVIAEENTNNVVSVGT 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/243 (26%)
Tryp_SPc 60..278 CDD:214473 62/235 (26%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113
Tryp_SPc 362..595 CDD:238113 62/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.