DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment b6 and NPTX1

DIOPT Version :10

Sequence 1:NP_477365.1 Gene:b6 / 31124 FlyBaseID:FBgn0024897 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_002513.2 Gene:NPTX1 / 4884 HGNCID:7952 Length:432 Species:Homo sapiens


Alignment Length:214 Identity:51/214 - (23%)
Similarity:80/214 - (37%) Gaps:60/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EDEAP--KEPLAFPRSPVYGSDRCSVKKFAFNQDGEVEYGNPMPELDQFTICFWMRFTNHSG--- 172
            :|..|  |..|.||....|  ....|||             .:||:..||:|.|::.:...|   
Human   220 KDNRPGDKFQLTFPLRTNY--MYAKVKK-------------SLPEMYAFTVCMWLKSSATPGVGT 269

  Fly   173 ---------DHVLLTYEAGKEPREVQIWVANAQNSSFLSMAIKGQQMYRLNYPLKMRQWHHMCSS 228
                     .:.|:..|.|..|.|:.|                ..::.:|.:.:...:|||:|.:
Human   270 PFSYAVPGQANELVLIEWGNNPMEILI----------------NDKVAKLPFVINDGKWHHICVT 318

  Fly   229 WNGKTGEWQAWLKAERIGRGFHNSLVGHKIPANGKL--------RSGGSSVT----GEVSHGLHF 281
            |..:.|.|:|:....:.|.| .|....|.|...|.|        ..||...|    ||::|...:
Human   319 WTTRDGVWEAYQDGTQGGSG-ENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIW 382

  Fly   282 EMTLV--QVYRVALSAGKA 298
            :..|.  :||.:|..:.||
Human   383 DRKLTPGEVYNLATCSTKA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
b6NP_477365.1 LamG 134..>264 CDD:473984 31/141 (22%)
NPTX1NP_002513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..122
GumC <120..>216 CDD:442439
PTX 222..428 CDD:128463 50/212 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.