DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32809 and zgc:114120

DIOPT Version :9

Sequence 1:NP_001245466.1 Gene:CG32809 / 31121 FlyBaseID:FBgn0023531 Length:1264 Species:Drosophila melanogaster
Sequence 2:NP_001028920.1 Gene:zgc:114120 / 619267 ZFINID:ZDB-GENE-050913-55 Length:224 Species:Danio rerio


Alignment Length:180 Identity:58/180 - (32%)
Similarity:91/180 - (50%) Gaps:19/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SQHPHAHQMAPQQQRAMDLEMSTRAQKNKKNQPMRGYAPVNQGPLFDDDPG-----------IMS 133
            |...|.....|.|..|  ..::|...:.:...| ||.|.:.|..|.:...|           .|:
Zfish    11 SDMEHQRSKYPPQHAA--TLVNTNCARQQARTP-RGAAGLQQQSLGEQVGGRVCYASAESLESMA 72

  Fly   134 EVETASTGFRRGGKQRSSLPVVRTPSKTLERPLGLVFLQYRSETKRALLPNEITSIDTVRALFVR 198
            :.| ...||.|....|.|||:.|:||:...|...::|||:..||:|..:.:|:||::|:.||.|.
Zfish    73 DAE-MPLGFSRSNILRQSLPLARSPSQAKLRAPAVLFLQFGDETRRVHITHELTSMETLHALIVH 136

  Fly   199 SFPRQLTMSYLEGPNVKIYIHDASKDMFYELEDVRSHLREIRDRSVLRLF 248
            .||::|||..|..|...:.|.|.::.:||||||.    |:|.||.:::::
Zfish   137 MFPQKLTMGALRSPGTALLIKDEARSIFYELEDP----RDIHDRCLIKIY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32809NP_001245466.1 AIP3 170..>247 CDD:281852 32/76 (42%)
zgc:114120NP_001028920.1 AIP3 108..>179 CDD:281852 32/74 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002249
OrthoInspector 1 1.000 - - otm25602
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.