DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hfw and Islr

DIOPT Version :9

Sequence 1:	NP_001259135.1	Gene:	hfw / 31120	FlyBaseID:	FBgn0001189	Length:	611	Species:	Drosophila melanogaster
Sequence 2:	NP_001119772.1	Gene:	Islr / 686539	RGDID:	1596359	Length:	428	Species:	Rattus norvegicus

Alignment Length:	202	Identity:	46/202 - (22%)
Similarity:	79/202 - (39%)	Gaps:	48/202 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   237 LQSLAVTDGNITRL-VNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVPH- 299
            ||||.:....|..: |.|...|..||.|::|:|.|||.....:.::..|:...|.:|.|:.:|.
  Rat    76 LQSLWLAHNEIRSVAVGALAPLGHLKSLDLSHNLISEFAWSDLHNLSALQLLKMDSNELAFIPRD 140

  Fly   300 --RNQNKNITLDISGN-MRMLC----TPLNEIIYTESINFLNPKHSYCQYNATHTWFQSTDKVSV 357
              |:.:...:|.::.| :..|.    .||..:.:.: ||. ||....|......||..:| .||:
  Rat   141 AFRSLHALRSLQLNHNRLHALAEGTFAPLTSLSHLQ-INH-NPFDCTCGIVWFKTWALAT-AVSI 202

  Fly   358 EQLEN---------RKRCVTNCPVIPNYGSCNCTLENIMIIQ---------------------DN 392
            .:.:|         :...::..|.:|      |:..::.:..                     |.
  Rat   203 PEQDNIACTSPHVLKGTPLSRLPPLP------CSAPSVQLSYQPSQDGAELRPGFVLALHCDVDG 261

  Fly   393 QSKPQCH 399
            |..||.|
  Rat   262 QPVPQLH 268

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hfw	NP_001259135.1	LRR_8	235..294	CDD:290566	19/57 (33%)
		leucine-rich repeat	237..259	CDD:275378	8/22 (36%)
		leucine-rich repeat	260..283	CDD:275378	8/22 (36%)
		leucine-rich repeat	284..304	CDD:275378	6/22 (27%)
		leucine-rich repeat	420..443	CDD:275378
		leucine-rich repeat	444..465	CDD:275378
		leucine-rich repeat	466..497	CDD:275378
		leucine-rich repeat	498..509	CDD:275378
Islr	NP_001119772.1	leucine-rich repeat	32..51	CDD:275380
		LRR_8	51..110	CDD:404697	13/33 (39%)
		leucine-rich repeat	52..75	CDD:275380
		leucine-rich repeat	76..99	CDD:275380	8/22 (36%)
		LRR_8	99..158	CDD:404697	16/58 (28%)
		leucine-rich repeat	100..123	CDD:275380	8/22 (36%)
		leucine-rich repeat	124..147	CDD:275380	6/22 (27%)
		leucine-rich repeat	148..171	CDD:275380	5/22 (23%)
		PCC	153..>227	CDD:188093	16/76 (21%)
		Ig	239..343	CDD:416386	5/30 (17%)
		Ig strand C	265..287	CDD:409353	3/4 (75%)
		Ig strand C'	288..290	CDD:409353
		Ig strand D	304..307	CDD:409353
		Ig strand E	310..316	CDD:409353
		Ig strand F	323..331	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24366
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100