DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and Aspn

DIOPT Version :9

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001165952.1 Gene:Aspn / 66695 MGIID:1913945 Length:373 Species:Mus musculus


Alignment Length:394 Identity:85/394 - (21%)
Similarity:131/394 - (33%) Gaps:136/394 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 CQCREHPTRPNSWYCCNISQLTMISSCSNISKWTNLHVRNMTVEDMDLSNPIFRSLQSLAVTDGN 246
            |||.....     :|   |.|.:.|..:||...|.:         :||.|...:.::.       
Mouse    72 CQCYSRVV-----HC---SDLGLTSVPNNIPFDTRM---------VDLQNNKIKEIKE------- 112

  Fly   247 ITRLVNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVP------------H 299
                 |.|..|::|..|.::||.:::||.:.......|....:|:|.||.:|            |
Mouse   113 -----NDFKGLTSLYALILNNNKLTKIHPKTFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIH 172

  Fly   300 RNQNKNITLDISGNMRMLCTPLNEIIYTESINFLNPKHSYCQYNATHTWFQSTDKVSVEQLENRK 364
            .|:.|.|..|....|                            ||.|..     ::|...|||. 
Mouse   173 DNKVKKIQKDTFKGM----------------------------NALHVL-----EMSANPLENN- 203

  Fly   365 RCVTNCPVIPNYGSCNCTLENIMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTFMLNITNNKIT 429
                  .:.|.      ..|.:.:.         |:..:...|..:|:.||.....|::..|||:
Mouse   204 ------GIEPG------AFEGVTVF---------HIRIAEAKLTSIPKGLPPTLLELHLDFNKIS 247

  Fly   430 S--LGDYFHTNPTYHNINRLLADNNQISSIYEFEGTKF--IETFQRIYMRNNSLSKIPEYFLNNA 490
            :  |.|.    ..|..:.||...||:|:.|   |...|  |...:.|::.:|.|.|||       
Mouse   248 TVELEDL----KRYRELQRLGLGNNRITDI---ENGTFANIPRVREIHLEHNKLKKIP------- 298

  Fly   491 LMDSGLGRRIYL----------AGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIE 545
               |||....||          |...:...|.:...::..|         |..|...|.|.:..|
Mouse   299 ---SGLQELKYLQIIFLHYNSIAKVGVNDFCPTVPKMKKSL---------YSAISLFNNPMKYWE 351

  Fly   546 LQEA 549
            :|.|
Mouse   352 IQPA 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 12/58 (21%)
leucine-rich repeat 237..259 CDD:275378 3/21 (14%)
leucine-rich repeat 260..283 CDD:275378 6/22 (27%)
leucine-rich repeat 284..304 CDD:275378 8/31 (26%)
leucine-rich repeat 420..443 CDD:275378 7/24 (29%)
leucine-rich repeat 444..465 CDD:275378 7/20 (35%)
leucine-rich repeat 466..497 CDD:275378 9/30 (30%)
leucine-rich repeat 498..509 CDD:275378 3/20 (15%)
AspnNP_001165952.1 LRRNT 68..97 CDD:214470 9/32 (28%)
leucine-rich repeat 77..96 CDD:275380 6/26 (23%)
LRR 1 96..117 6/41 (15%)
leucine-rich repeat 97..120 CDD:275380 7/43 (16%)
LRR_8 98..155 CDD:290566 15/77 (19%)
LRR 2 120..141 6/20 (30%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_RI <139..333 CDD:238064 55/265 (21%)
LRR 3 144..166 6/21 (29%)
leucine-rich repeat 145..165 CDD:275380 6/19 (32%)
Interaction with TGFB1 159..205 14/85 (16%)
leucine-rich repeat 166..189 CDD:275380 6/50 (12%)
LRR 5 189..212 7/40 (18%)
leucine-rich repeat 190..215 CDD:275380 7/42 (17%)
LRR_8 234..294 CDD:290566 18/66 (27%)
LRR 6 235..255 6/23 (26%)
leucine-rich repeat 236..259 CDD:275380 7/26 (27%)
LRR 7 259..280 8/23 (35%)
leucine-rich repeat 260..283 CDD:275380 9/25 (36%)
LRR 8 283..305 9/31 (29%)
LRR 9 306..327 3/20 (15%)
leucine-rich repeat 307..331 CDD:275380 3/23 (13%)
LRR 10 328..349 5/29 (17%)
leucine-rich repeat 332..359 CDD:275380 8/33 (24%)
LRR 11 350..373 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.