DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and si:ch211-237i5.4

DIOPT Version :9

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_001920877.1 Gene:si:ch211-237i5.4 / 557635 ZFINID:ZDB-GENE-131121-468 Length:346 Species:Danio rerio


Alignment Length:407 Identity:89/407 - (21%)
Similarity:143/407 - (35%) Gaps:122/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 CQCREHPTRPNSWYCCNISQLTMISSCSNISKWTNLHVRNMTVEDMDLSNPIFRSLQSLAVTDGN 246
            |||.||                        |...:.|.|..  ||:....|....|..|.   ||
Zfish    25 CQCYEH------------------------SDLVDCHARGF--EDVPHGLPHGTWLLDLG---GN 60

  Fly   247 -ITRL-VNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVPHRNQNKNITLD 309
             :|.: ..||..|.:|:.|.:|::||..:.|:|...:..||...||:|||:.:|     .|.:..
Zfish    61 RLTEIRSRAFAGLWSLRILVLSDSNIQALQSQAFFSLSFLEKLDMSHNNLTQIP-----PNFSES 120

  Fly   310 ISGNMRMLCTPLNEIIYTESINFLNP---KH--SYCQYNATHTWFQSTDKVSVEQLENRKRCVTN 369
            :| ::|.|....|      ::..|.|   :|  :..:.:.:|...||.:..:...|...:.    
Zfish   121 LS-SLRELRLDHN------ALQLLKPPGLEHLENLAKLDLSHNHIQSLEPGAFRGLSRLRH---- 174

  Fly   370 CPVIPNYGSCNCTLENIMIIQDNQSKPQCHVD-CSNLGLVELPQRLPDNTFMLNITNNKITSLGD 433
                             :.:|.|      |:| ..:..|..||.     ..:|.:.||.|:.:  
Zfish   175 -----------------LYLQGN------HLDVIRDRSLTMLPA-----LEVLQLGNNNISQI-- 209

  Fly   434 YFHTNPTYHNINRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGR 498
            ..:.....|:::.|..:.||:..:.       .:||.       ||.....:.|           
Zfish   210 EVNALAPLHSLSLLGLEGNQLEHLN-------FKTFL-------SLRTATTHLL----------- 249

  Fly   499 RIYLAGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQEAKLCQSPPDWTDYIY 563
               |:||...|||:..:.....|..|...:.||..:.||...|    |..|.|.     |.|  .
Zfish   250 ---LSGNPWSCDCDLHRVFSKLLSVRHLHVDDYHNVTCREPWQ----LAGASLA-----WVD--S 300

  Fly   564 YLIAAEVLLLLALITKV 580
            .|..||.:.:|.:...|
Zfish   301 QLCVAETVTVLVITATV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 20/60 (33%)
leucine-rich repeat 237..259 CDD:275378 8/23 (35%)
leucine-rich repeat 260..283 CDD:275378 7/22 (32%)
leucine-rich repeat 284..304 CDD:275378 8/19 (42%)
leucine-rich repeat 420..443 CDD:275378 4/22 (18%)
leucine-rich repeat 444..465 CDD:275378 3/20 (15%)
leucine-rich repeat 466..497 CDD:275378 5/30 (17%)
leucine-rich repeat 498..509 CDD:275378 3/10 (30%)
si:ch211-237i5.4XP_001920877.1 leucine-rich repeat 34..53 CDD:275380 5/20 (25%)
leucine-rich repeat 54..75 CDD:275380 8/23 (35%)
LRR_RI <69..238 CDD:238064 45/221 (20%)
LRR_8 75..134 CDD:290566 20/70 (29%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 10/28 (36%)
LRR_8 122..182 CDD:290566 13/93 (14%)
leucine-rich repeat 124..147 CDD:275380 6/28 (21%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
LRR_8 170..230 CDD:290566 14/93 (15%)
leucine-rich repeat 172..195 CDD:275380 6/49 (12%)
leucine-rich repeat 196..219 CDD:275380 4/24 (17%)
leucine-rich repeat 220..240 CDD:275380 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.