| Sequence 1: | NP_001259135.1 | Gene: | hfw / 31120 | FlyBaseID: | FBgn0001189 | Length: | 611 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013541.1 | Gene: | islr2 / 541396 | ZFINID: | ZDB-GENE-050320-95 | Length: | 712 | Species: | Danio rerio |
| Alignment Length: | 206 | Identity: | 53/206 - (25%) |
|---|---|---|---|
| Similarity: | 79/206 - (38%) | Gaps: | 57/206 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 400 VDCSNLGLVELPQRLPDNTFMLNITNNKITSLGDYFHTNPTY-------HN-------------- 443
Fly 444 -INRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGRRIYLAGNK- 506
Fly 507 ----------------LQ-------CDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQE 548
Fly 549 AKL----CQSP 555 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hfw | NP_001259135.1 | LRR_8 | 235..294 | CDD:290566 | |
| leucine-rich repeat | 237..259 | CDD:275378 | |||
| leucine-rich repeat | 260..283 | CDD:275378 | |||
| leucine-rich repeat | 284..304 | CDD:275378 | |||
| leucine-rich repeat | 420..443 | CDD:275378 | 7/29 (24%) | ||
| leucine-rich repeat | 444..465 | CDD:275378 | 5/20 (25%) | ||
| leucine-rich repeat | 466..497 | CDD:275378 | 9/30 (30%) | ||
| leucine-rich repeat | 498..509 | CDD:275378 | 6/34 (18%) | ||
| islr2 | NP_001013541.1 | leucine-rich repeat | 35..53 | CDD:275380 | 8/15 (53%) |
| LRR_RI | <47..>184 | CDD:238064 | 33/141 (23%) | ||
| LRR_8 | 53..113 | CDD:290566 | 13/59 (22%) | ||
| leucine-rich repeat | 57..78 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 102..161 | CDD:290566 | 17/63 (27%) | ||
| leucine-rich repeat | 103..126 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 127..150 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 151..174 | CDD:275380 | 4/25 (16%) | ||
| LRRCT | 183..>221 | CDD:214507 | 11/39 (28%) | ||
| IG_like | 252..345 | CDD:214653 | |||
| Ig | 256..345 | CDD:299845 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24366 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||