DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and kek6

DIOPT Version :9

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster


Alignment Length:379 Identity:69/379 - (18%)
Similarity:118/379 - (31%) Gaps:156/379 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 SWYCCNISQLTMISSCSNISKWTNLHVRNMTVEDMDLS---NPIFRSLQSLAVTDGNITRLVNAF 254
            :|...:...|:..|:|:  .|||| ..::.....:.|:   |.:...||.|.:.|.:|..|..  
  Fly    27 AWTVADDWSLSCASNCT--CKWTN-GKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLNR-- 86

  Fly   255 PRLSALKCLN-----ISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVPHRNQNKNITLDISGNM 314
            ...|.|..||     :..:.:..||..:.:::..|....:|:|.|.::     :|:..:   ||.
  Fly    87 EEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEML-----DKDTFM---GND 143

  Fly   315 RMLCTPLNEIIYTESINFLNPKHSYCQYNATHTWFQSTDKVSVEQLENRKRCVTNCPVIPNYGSC 379
            |:      .|:|...    ||......|                          ..|::|:..:.
  Fly   144 RL------RILYLNG----NPLKRLAAY--------------------------QFPILPHLRTL 172

  Fly   380 ---NCTLENIMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTFMLNITNNKITSLGDYFHTNPTY 441
               :|.:..|    |..|       .:||.|:|          .||:.||.:.||.:|       
  Fly   173 DMHDCLISYI----DPMS-------LANLNLLE----------FLNLKNNLLESLSEY------- 209

  Fly   442 HNINRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGRRIYLAGNK 506
                                      .||  :|.|.....:.|                    |.
  Fly   210 --------------------------VFQ--HMANLKTLSLEE--------------------NP 226

  Fly   507 LQCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQEAKLCQSPPDWTD 560
            .||:|...| .:.|          |:..|..::         :.:|:.||...|
  Fly   227 WQCNCKLRK-FRGW----------YVNSRLSSV---------SLVCKGPPAQKD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 15/63 (24%)
leucine-rich repeat 237..259 CDD:275378 6/21 (29%)
leucine-rich repeat 260..283 CDD:275378 5/27 (19%)
leucine-rich repeat 284..304 CDD:275378 4/19 (21%)
leucine-rich repeat 420..443 CDD:275378 7/22 (32%)
leucine-rich repeat 444..465 CDD:275378 0/20 (0%)
leucine-rich repeat 466..497 CDD:275378 5/30 (17%)
leucine-rich repeat 498..509 CDD:275378 1/10 (10%)
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 8/26 (31%)
LRR_8 96..155 CDD:290566 14/76 (18%)
leucine-rich repeat 97..120 CDD:275380 2/22 (9%)
leucine-rich repeat 121..144 CDD:275380 7/30 (23%)
LRR_4 144..186 CDD:289563 11/81 (14%)
leucine-rich repeat 145..168 CDD:275380 6/58 (10%)
leucine-rich repeat 169..216 CDD:275380 18/102 (18%)
LRRCT 225..274 CDD:214507 12/56 (21%)
Ig 295..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.