DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hfw and Lapsyn

DIOPT Version :9

Sequence 1:	NP_001259135.1	Gene:	hfw / 31120	FlyBaseID:	FBgn0001189	Length:	611	Species:	Drosophila melanogaster
Sequence 2:	NP_611561.1	Gene:	Lapsyn / 37418	FlyBaseID:	FBgn0034602	Length:	343	Species:	Drosophila melanogaster

Alignment Length:	130	Identity:	39/130 - (30%)
Similarity:	62/130 - (47%)	Gaps:	21/130 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   388 IIQDNQSKPQC---HVD------CSNLGLVELPQRLPDNTFMLNITNNKITSLGDYFHTNPTYHN 443
            |||....|  |   |:|      |.:|.|.|:||.|..:..:|::::|:|..|..  .:...|.:
  Fly    23 IIQSEVRK--CTYGHIDKLLRIRCYDLDLKEVPQNLKSSVEVLDLSHNRIRKLKT--SSFQRYTD 83

  Fly   444 INRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIP-EYFLNNALMDSGLGRRIYLAGNKL 507
            |..|:..:|.|.|: |....:.:.:.|.|.:.||.|:.|| |.|....|      |.:|:..|:|
  Fly    84 IKFLMLYDNMILSV-EVGTFEPLTSLQEIDLSNNGLTTIPLELFQLPRL------RNLYIDSNEL 141

Fly 508 507
Fly 142 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hfw	NP_001259135.1	LRR_8	235..294	CDD:290566
		leucine-rich repeat	237..259	CDD:275378
		leucine-rich repeat	260..283	CDD:275378
		leucine-rich repeat	284..304	CDD:275378
		leucine-rich repeat	420..443	CDD:275378	5/22 (23%)
		leucine-rich repeat	444..465	CDD:275378	6/20 (30%)
		leucine-rich repeat	466..497	CDD:275378	10/31 (32%)
		leucine-rich repeat	498..509	CDD:275378	4/10 (40%)
Lapsyn	NP_611561.1	leucine-rich repeat	39..59	CDD:275380	7/19 (37%)
		LRR_8	58..118	CDD:290566	15/62 (24%)
		leucine-rich repeat	60..83	CDD:275380	5/24 (21%)
		leucine-rich repeat	84..107	CDD:275380	6/23 (26%)
		LRR_RI	<94..>249	CDD:238064	17/55 (31%)
		LRR_8	106..167	CDD:290566	14/42 (33%)
		LRR_4	106..145	CDD:289563	14/42 (33%)
		leucine-rich repeat	108..130	CDD:275380	9/21 (43%)
		leucine-rich repeat	131..154	CDD:275380	5/17 (29%)
		leucine-rich repeat	157..178	CDD:275380
		leucine-rich repeat	179..202	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24366
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100