DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and Lrt

DIOPT Version :9

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:651 Identity:140/651 - (21%)
Similarity:224/651 - (34%) Gaps:227/651 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SLAETQSMSDPGSVTDTTSTSTSHSTSTTSTTSPAPLPPAAPEQPEYLKHCFYAEEQLCGHTFDG 154
            :||....:.|  .:.|:|   ||.||||||:|.|:.:  .:|..|.    .:............|
  Fly    38 TLAAANDLKD--LLEDST---TSSSTSTTSSTIPSSV--TSPTTPT----AYVVSAAAVPALVAG 91

  Fly   155 RAETSEGQGSTVAQSEAQNR------------------------GGQGNSQCQC---REHPTRPN 192
            |.::....|..|.:|..:.|                        .|..|::.:|   ..|..|  
  Fly    92 RGKSKSTSGKYVNKSSPRKRKAEQVSSLPLPVDDALMEWKCPNITGTRNAELECGCDLPHTLR-- 154

  Fly   193 SWYCCNISQLTMI-------SSCSNISKWTNLHVRNMT-VEDMDLSNPIFRSLQSLAVTDGNITR 249
                |||....|:       :|..:|| ..:..:||:| :.|..:.:.:  ||..|.::.|.|.|
  Fly   155 ----CNIDLHGMMLLADRLRTSPYSIS-LLDCSLRNVTFLSDAKIFDNV--SLHGLVISSGEIKR 212

  Fly   250 L--------------------------VNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFG 288
            :                          .||...||||:.|:::||.|..:.:.....:..|.:..
  Fly   213 VHKSAFLGIRGPLQALGLPGNALMSVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLE 277

  Fly   289 MSNNNLSLVPHR---NQNKNITLDISGNMRMLCTPLNEIIYTESINFLNPKHSYCQYNATHTWFQ 350
            :|||.:|.:..|   |..|...|.:.||.      |.:  |.:|:..|    |.|          
  Fly   278 LSNNQISSISQRTFVNLRKLEVLKLGGNR------LGD--YAQSLRSL----SQC---------- 320

  Fly   351 STDKVSVEQLE------NRKRCVTNCPVIPNYGSCNCTLENIMIIQD----------------NQ 393
                :|:.||:      |........|.:.|..|.|.....|..||:                ||
  Fly   321 ----LSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQ 381

  Fly   394 -SKPQCH----------VDCSNLGLVELP----QRLPDNTFMLNITNNKITSL-GDYFHTNPTYH 442
             ...|.|          :|.|..|:|.:.    |.|...| :|::|:|.:.:| .|.....|:..
  Fly   382 IDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLT-VLDLTHNFLRALTSDLIAPLPSLR 445

  Fly   443 NINRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGRRIYLAGNKL 507
            .: ||..::..|.:....:|.:.:|:.|   |:.|.||                           
  Fly   446 EL-RLAGNDISIVARNAMDGARELESLQ---MQENPLS--------------------------- 479

  Fly   508 QCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQEAKLCQSP----------------- 555
             ||| |.:....||:|  |.:...:...|...|:    |:.|.|.|.|                 
  Fly   480 -CDC-SIRPFAEWLQE--SQLHSSLSASCVTPPR----LEGAPLLQVPVETLSCDMDNVEKDNAN 536

  Fly   556 ----------PDWTDYIYYLIAAEVLLLLALITKVSYDYWVFKTAGYLPWPASKMPKLPCDWLCE 610
                      |:.|..|..|  :|.::|..|  ..|.||.:.     |.|..:...|   |::|:
  Fly   537 IMQHLETLAKPNQTSPIKDL--SEEIILHEL--HFSTDYGLI-----LTWLLNLSKK---DYMCD 589

  Fly   611 S 611
            :
  Fly   590 A 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 20/84 (24%)
leucine-rich repeat 237..259 CDD:275378 8/47 (17%)
leucine-rich repeat 260..283 CDD:275378 5/22 (23%)
leucine-rich repeat 284..304 CDD:275378 7/22 (32%)
leucine-rich repeat 420..443 CDD:275378 6/23 (26%)
leucine-rich repeat 444..465 CDD:275378 4/20 (20%)
leucine-rich repeat 466..497 CDD:275378 6/30 (20%)
leucine-rich repeat 498..509 CDD:275378 0/10 (0%)
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 49/217 (23%)
leucine-rich repeat 179..199 CDD:275378 4/21 (19%)
leucine-rich repeat 200..223 CDD:275380 5/22 (23%)
leucine-rich repeat 225..248 CDD:275380 3/22 (14%)
LRR_8 249..307 CDD:290566 16/63 (25%)
leucine-rich repeat 249..272 CDD:275380 5/22 (23%)
LRR_RI <270..479 CDD:238064 53/239 (22%)
leucine-rich repeat 273..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..322 CDD:275380 9/50 (18%)
LRR_8 322..382 CDD:290566 12/59 (20%)
leucine-rich repeat 323..347 CDD:275380 4/23 (17%)
leucine-rich repeat 348..371 CDD:275380 5/22 (23%)
LRR_8 370..428 CDD:290566 13/58 (22%)
leucine-rich repeat 372..395 CDD:275380 4/22 (18%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
LRR_8 418..478 CDD:290566 15/64 (23%)
leucine-rich repeat 420..443 CDD:275380 6/23 (26%)
leucine-rich repeat 444..467 CDD:275380 4/23 (17%)
LRRCT 476..526 CDD:214507 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.