Sequence 1: | NP_001259135.1 | Gene: | hfw / 31120 | FlyBaseID: | FBgn0001189 | Length: | 611 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 59/209 - (28%) |
---|---|---|---|
Similarity: | 87/209 - (41%) | Gaps: | 57/209 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 370 CPVIPNYGSCNCTLENIMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTFMLNITNNKITSL-GD 433
Fly 434 YFHTNPTYHNINRLLADNNQISSIYEFEGTKFIETFQRIY--MRNNSLSKIPEYFL--NNALMDS 494
Fly 495 GLGRRIYLAGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRN-------------MPQ-RVIE 545
Fly 546 L-QEAKLCQSPPDW 558 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hfw | NP_001259135.1 | LRR_8 | 235..294 | CDD:290566 | |
leucine-rich repeat | 237..259 | CDD:275378 | |||
leucine-rich repeat | 260..283 | CDD:275378 | |||
leucine-rich repeat | 284..304 | CDD:275378 | |||
leucine-rich repeat | 420..443 | CDD:275378 | 8/23 (35%) | ||
leucine-rich repeat | 444..465 | CDD:275378 | 7/20 (35%) | ||
leucine-rich repeat | 466..497 | CDD:275378 | 10/34 (29%) | ||
leucine-rich repeat | 498..509 | CDD:275378 | 5/10 (50%) | ||
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 20/65 (31%) |
LRR_RI | <76..230 | CDD:238064 | 48/161 (30%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 9/26 (35%) | ||
LRR_8 | 122..182 | CDD:290566 | 21/75 (28%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 10/38 (26%) | ||
LRR_8 | 170..230 | CDD:290566 | 12/45 (27%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |