DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and kek1

DIOPT Version :9

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:484 Identity:94/484 - (19%)
Similarity:180/484 - (37%) Gaps:155/484 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HAHPHAPLKEDEQGTAIPAPILTTDNVGIGETTTASSLAETQSMSDPGSVTDTTSTSTSHSTSTT 118
            |.:.:........|...|||         .......|:|::|.|::.|.:..:.....:||    
  Fly    27 HLYANGGASSSGPGGYRPAP---------SSQNEVYSIADSQPMTEDGYMPPSQHFPPTHS---- 78

  Fly   119 STTSPAPLPPAAPEQPEYLKHCFYAEEQLCGHTFDGRAETSEGQGSTVAQSEAQNRGGQGNSQC- 182
                  .|.|.|.:|    ..|    :.:|.                     .:.:||:...:| 
  Fly    79 ------DLDPPAQQQ----STC----QTVCA---------------------CKWKGGKQTVECI 108

  Fly   183 -----QCREHPTRPNSWYC-CNISQLTMISS----CSNISKWTNLHVRNMTVEDMDLSNPIFRSL 237
                 |..|| ..||:... .:.::|..:|:    .:|:.....|::||..:.:::  ...|:.|
  Fly   109 DRHLIQIPEH-IDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIE--RETFKGL 170

  Fly   238 QSLAVTDGNITRLVN----AFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNLSLVP 298
            .:|...|.:...||.    |...:.:|:.|.:::|:|.:|.|:|..:.|.|....:|:.::..:.
  Fly   171 TNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTIS 235

  Fly   299 HR--NQNKNITLDISGNMRMLCTPLNEIIYTESINFLNPKHSYCQYNATHTWFQSTDKVSVEQLE 361
            .:  ...:.:||     :|:....|:|:: .::|..|:..|                  .:|..:
  Fly   236 AQAFGGLQGLTL-----LRLNGNKLSELL-PKTIETLSRLH------------------GIELHD 276

  Fly   362 NRKRCVTNCPVIPNYGSCNCTLEN--IMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTF----- 419
            |        |.:     |:|.|.:  :.:::.|...|...| ||. |    |:|:.|.:|     
  Fly   277 N--------PWL-----CDCRLRDTKLWLMKRNIPYPVAPV-CSG-G----PERIIDRSFADLHV 322

  Fly   420 --------MLNITNNKITSLGDYFHTNPTYH-------NIN-----RLLADNNQISSIYEFEGTK 464
                    ||.|::....::|:  :.:.|..       |||     ||||:|:..::        
  Fly   323 DEFACRPEMLPISHYVEAAMGE--NASITCRARAVPAANINWYWNGRLLANNSAFTA-------- 377

  Fly   465 FIETFQRIYMR---NNSLSKIPEYFLNNA 490
                :|||:|.   .....|..:..|.||
  Fly   378 ----YQRIHMLEQVEGGFEKRSKLVLTNA 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 16/62 (26%)
leucine-rich repeat 237..259 CDD:275378 6/25 (24%)
leucine-rich repeat 260..283 CDD:275378 7/22 (32%)
leucine-rich repeat 284..304 CDD:275378 2/21 (10%)
leucine-rich repeat 420..443 CDD:275378 5/29 (17%)
leucine-rich repeat 444..465 CDD:275378 7/25 (28%)
leucine-rich repeat 466..497 CDD:275378 8/28 (29%)
leucine-rich repeat 498..509 CDD:275378
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/19 (21%)
LRR_RI <119..277 CDD:238064 34/183 (19%)
leucine-rich repeat 123..148 CDD:275380 3/24 (13%)
LRR_8 148..207 CDD:290566 13/60 (22%)
leucine-rich repeat 149..172 CDD:275380 5/24 (21%)
leucine-rich repeat 173..196 CDD:275380 5/22 (23%)
LRR_8 195..255 CDD:290566 13/64 (20%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
leucine-rich repeat 221..244 CDD:275380 2/22 (9%)
leucine-rich repeat 245..268 CDD:275380 7/28 (25%)
LRRCT 277..327 CDD:214507 15/68 (22%)
IG_like 338..429 CDD:214653 18/79 (23%)
Ig 346..426 CDD:143165 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.