| Sequence 1: | NP_001259135.1 | Gene: | hfw / 31120 | FlyBaseID: | FBgn0001189 | Length: | 611 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001155007.1 | Gene: | Islr2 / 320563 | MGIID: | 2444277 | Length: | 789 | Species: | Mus musculus |
| Alignment Length: | 247 | Identity: | 50/247 - (20%) |
|---|---|---|---|
| Similarity: | 73/247 - (29%) | Gaps: | 94/247 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 401 DCSNLGLVELPQRLPDNTFMLNITNNKITSLGDYFHTNPTY-------HN--------------- 443
Fly 444 INRLLADNNQISSIYEFEGTKFIETFQRIYMRNNSLSKIPEYFL------------NNALMDSGL 496
Fly 497 G--------RRIYLAGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRNMPQRVIELQEAKLCQ 553
Fly 554 SPPDWTDYIYYLIAAEVLLLLALITKVSYDYWVFKTAGYLPWPASKMPKLPC 605 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hfw | NP_001259135.1 | LRR_8 | 235..294 | CDD:290566 | |
| leucine-rich repeat | 237..259 | CDD:275378 | |||
| leucine-rich repeat | 260..283 | CDD:275378 | |||
| leucine-rich repeat | 284..304 | CDD:275378 | |||
| leucine-rich repeat | 420..443 | CDD:275378 | 8/29 (28%) | ||
| leucine-rich repeat | 444..465 | CDD:275378 | 4/20 (20%) | ||
| leucine-rich repeat | 466..497 | CDD:275378 | 9/42 (21%) | ||
| leucine-rich repeat | 498..509 | CDD:275378 | 2/10 (20%) | ||
| Islr2 | NP_001155007.1 | leucine-rich repeat | 80..96 | CDD:275380 | 7/15 (47%) |
| LRR_8 | 96..155 | CDD:290566 | 12/58 (21%) | ||
| leucine-rich repeat | 97..120 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 1/22 (5%) | ||
| LRR_4 | 144..183 | CDD:289563 | 8/39 (21%) | ||
| leucine-rich repeat | 145..168 | CDD:275380 | 4/23 (17%) | ||
| LRR_8 | 164..227 | CDD:290566 | 12/62 (19%) | ||
| LRR_4 | 169..208 | CDD:289563 | 9/38 (24%) | ||
| leucine-rich repeat | 169..192 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 193..216 | CDD:275380 | 4/22 (18%) | ||
| LRRCT | 225..273 | CDD:214507 | 15/98 (15%) | ||
| Ig_2 | 288..417 | CDD:290606 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24366 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||