DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3740 and LOC690000

DIOPT Version :9

Sequence 1:NP_569932.1 Gene:CG3740 / 31119 FlyBaseID:FBgn0023530 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_006228976.1 Gene:LOC690000 / 690000 RGDID:1585208 Length:145 Species:Rattus norvegicus


Alignment Length:138 Identity:51/138 - (36%)
Similarity:89/138 - (64%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGIAAYKM 65
            |||...::|:.:..:..|:.::.|||.||:||.:..|.:|.||::.||.||||||..||:....|
  Rat     5 MPIMVDDIMKLLCSICQEKKMKAAVKHSGRGAVVVGAMAFVGGLVGGPPGLAVGGTVGGLLGAWM 69

  Fly    66 TSGTFRPLGEVILNDLTDAQREQLVQHVTMAVADIHPTDVVMLLPLIVQNASIQQAVLNTVMSFV 130
            |||.|:|:.:::: :|..|::::||...|..:.::..||.|.|..|::.|.::||.:|..:.::|
  Rat    70 TSGQFKPVPQILM-ELPPAEQQKLVNEATAIIRNLDWTDAVQLTALVMSNQAMQQKLLAMLTTYV 133

  Fly   131 TNELRMQI 138
            |.||:.:|
  Rat   134 TKELQAEI 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354367
Domainoid 1 1.000 107 1.000 Domainoid score I6395
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41744
Inparanoid 1 1.050 107 1.000 Inparanoid score I4829
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 1 1.000 - - oto96575
orthoMCL 1 0.900 - - OOG6_107955
Panther 1 1.100 - - LDO PTHR31493
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.