DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3740 and zgc:112052

DIOPT Version :9

Sequence 1:NP_569932.1 Gene:CG3740 / 31119 FlyBaseID:FBgn0023530 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001017665.2 Gene:zgc:112052 / 550358 ZFINID:ZDB-GENE-050417-151 Length:141 Species:Danio rerio


Alignment Length:138 Identity:56/138 - (40%)
Similarity:88/138 - (63%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGIAAYKM 65
            ||....::|:....::..:.|:.||||||||||.....:||||::.||:|:|||||.||:....|
Zfish     1 MPPHVDDVMKLCCELSANQQVKTAVKQSGKGAAAAGGLAFAGGLIGGPLGIAVGGAVGGLLGCWM 65

  Fly    66 TSGTFRPLGEVILNDLTDAQREQLVQHVTMAVADIHPTDVVMLLPLIVQNASIQQAVLNTVMSFV 130
            |||.|:||.:||: :||..|:.:|.:.:...:..|..|||..|..|::.|||:||.|...::|::
Zfish    66 TSGQFKPLPQVIM-ELTPDQQARLYEDIVAILGSITWTDVAQLTALVMGNASLQQQVTAALLSYI 129

  Fly   131 TNELRMQI 138
            ..||:.::
Zfish   130 HKELQAEV 137



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596655
Domainoid 1 1.000 105 1.000 Domainoid score I6567
eggNOG 1 0.900 - - E1_2ASQN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4918
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 1 1.000 - - otm25648
orthoMCL 1 0.900 - - OOG6_107955
Panther 1 1.100 - - LDO PTHR31493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5860
SonicParanoid 1 1.000 - - X2933
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.