Sequence 1: | NP_569932.1 | Gene: | CG3740 / 31119 | FlyBaseID: | FBgn0023530 | Length: | 140 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649778.1 | Gene: | Nazo / 40976 | FlyBaseID: | FBgn0037562 | Length: | 140 | Species: | Drosophila melanogaster |
Alignment Length: | 134 | Identity: | 64/134 - (47%) |
---|---|---|---|
Similarity: | 97/134 - (72%) | Gaps: | 0/134 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 ELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGIAAYKMTSGTFR 71
Fly 72 PLGEVILNDLTDAQREQLVQHVTMAVADIHPTDVVMLLPLIVQNASIQQAVLNTVMSFVTNELRM 136
Fly 137 QIVD 140 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 105 | 1.000 | Domainoid score | I6567 |
eggNOG | 1 | 0.900 | - | - | E1_2ASQN | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 105 | 1.000 | Inparanoid score | I4918 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG50112 | |
OrthoDB | 1 | 1.010 | - | - | D1474873at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003581 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR31493 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X2933 | |
9 | 8.980 |