DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3740 and Nazo

DIOPT Version :9

Sequence 1:NP_569932.1 Gene:CG3740 / 31119 FlyBaseID:FBgn0023530 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_649778.1 Gene:Nazo / 40976 FlyBaseID:FBgn0037562 Length:140 Species:Drosophila melanogaster


Alignment Length:134 Identity:64/134 - (47%)
Similarity:97/134 - (72%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGIAAYKMTSGTFR 71
            |::.|:||:||::|:::.:|::||||||||..:..||:||||.|||:|||.||:.||.:|.|.|:
  Fly     7 EIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGLTEGNFK 71

  Fly    72 PLGEVILNDLTDAQREQLVQHVTMAVADIHPTDVVMLLPLIVQNASIQQAVLNTVMSFVTNELRM 136
            .|.||||||||::||.:|.|||..|::::....|..:..||:.|..:|:..|..|.|::|:.:.|
  Fly    72 SLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVARLILNNRHVQEVALEAVKSYITDRMGM 136

  Fly   137 QIVD 140
            .|||
  Fly   137 TIVD 140



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6567
eggNOG 1 0.900 - - E1_2ASQN
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4918
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31493
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2933
98.980

Return to query results.
Submit another query.