DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3740 and si:ch211-260e23.8

DIOPT Version :9

Sequence 1:NP_569932.1 Gene:CG3740 / 31119 FlyBaseID:FBgn0023530 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001373680.1 Gene:si:ch211-260e23.8 / 100537173 ZFINID:ZDB-GENE-141216-116 Length:143 Species:Danio rerio


Alignment Length:140 Identity:50/140 - (35%)
Similarity:83/140 - (59%) Gaps:3/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIDTR--ELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGIAAY 63
            |.:.:|  ::|:....|:..|.::.|||.||||||.....:|.|||:.||.|:||||..||:...
Zfish     1 MTMSSRVDDVMQLCCEVSASRKIKAAVKSSGKGAAAAGGGAFVGGMVGGPAGIAVGGTLGGLLGT 65

  Fly    64 KMTSGTFRPLGEVILNDLTDAQREQLVQHVTMAVADIHPTDVVMLLPLIVQNASIQQAVLNTVMS 128
            .:|||.|:|..|:| .:|....:|.|...:..|::.::.|||..|:.|::.:.::|:.||..:.:
Zfish    66 WITSGQFKPFPEII-EELPPKYKEVLYSDIMAALSSLNWTDVASLIALVMGSVTLQEQVLAAIHT 129

  Fly   129 FVTNELRMQI 138
            |.|.||..::
Zfish   130 FATKELNAEL 139



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596653
Domainoid 1 1.000 105 1.000 Domainoid score I6567
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41744
Inparanoid 1 1.050 105 1.000 Inparanoid score I4918
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 1 1.000 - - otm25648
orthoMCL 1 0.900 - - OOG6_107955
Panther 1 1.100 - - O PTHR31493
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5860
SonicParanoid 1 1.000 - - X2933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.030

Return to query results.
Submit another query.