DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and Gasp

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:83/225 - (36%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RCSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGR-------------CVQHVPQH 140
            :|..:: |..||......|:.|.........|....:|:|:..:             |.... :.
  Fly    22 KCPDDF-GFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRT-EL 84

  Fly   141 RPDHRPPQCQK-EGRFPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQ---CPST 201
            .|....|.|.: .|.||..:.|.|::.|...  :|..:.|..|..:....|.|:..||   |.:.
  Fly    85 EPPITTPHCSRLYGIFPDENKCDVFWNCWNG--EPSRYQCSPGLAYDRDARVCMWADQVPECKNE 147

  Fly   202 EISDSGSYIPQNCELKFPECAEEGTF---RSPTDCALYYTCR---LQESGTYLQTRFK------- 253
            |:: :|...|...||     |..|:|   ..|.||..||.|.   .:|.|..:.|.||       
  Fly   148 EVA-NGFSCPAAGEL-----ANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGT 206

  Fly   254 --C------PGSNSF--DLERKLCRPRSEV 273
              |      ||...:  ||:.|..| :||:
  Fly   207 GNCEDPEDVPGCEDYYGDLDLKSIR-KSEL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 10/59 (17%)
CBM_14 150..197 CDD:279884 11/47 (23%)
CBM_14 221..275 CDD:279884 23/76 (30%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 9/50 (18%)
CBM_14 97..144 CDD:366726 13/48 (27%)
CBM_14 170..218 CDD:366726 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.