DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG17147

DIOPT Version :10

Sequence 1:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:198 Identity:50/198 - (25%)
Similarity:75/198 - (37%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DYNNRCSRNYIGIKPH-PDQQQYYYVCKPDCVIFSKCRGLESFNASSGRCVQHVPQHRPDHRPPQ 148
            :|...|.....|.|.. |.....|..|.........|...:|||.|.|.||..:.... .:...:
  Fly    27 EYEELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSCVDTLANSN-KYCGNR 90

  Fly   149 CQ-KEGRF-PHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQCPSTEISDSGSYIP 211
            |: .:|.: ..|.:|..|:.|...  .|....||.|..|....:.||.|......::::.     
  Fly    91 CEGLDGEWVADPTECHKYFYCMNG--VPLAGMCPVGQHFDERSQSCLYGVDSMCVDVNNI----- 148

  Fly   212 QNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNS----FDLERKLCRPRSE 272
              |||    .||...||:..|||.||.|  .::|.:...  .|..::.    ||:|...|...::
  Fly   149 --CEL----VAENTKFRNEKDCAYYYEC--DKTGNHASK--SCTVTSKKREYFDVESGNCVEANK 203

  Fly   273 VDC 275
            |:|
  Fly   204 VEC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696 14/48 (29%)
CBM_14 150..197 CDD:426342 13/48 (27%)
CBM_14 221..275 CDD:426342 17/57 (30%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/32 (28%)
ChtBD2 89..136 CDD:214696 12/48 (25%)
CBM_14 278..332 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.