DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and obst-F

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:208 Identity:46/208 - (22%)
Similarity:74/208 - (35%) Gaps:70/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NASSGRCVQHVPQHRPDHRPPQCQKEGRF--PHPHDCKVYYRC---DKNRTQPWLFACPAGTIFS 186
            :.:||:.|..:.::.|:|  .:|:..|.:  |||.:|.:|:.|   ..:|.|     |..||.::
  Fly   129 DVTSGQPVNPMEKYDPEH--IECRHYGAYFLPHPRNCGLYFICAYGHLHRHQ-----CGRGTAWN 186

  Fly   187 PVERKCLPGDQC----------PSTEI---------SDSGS----YIPQNCE-------LKFPEC 221
            ..:.:|...||.          |.|::         :..|:    ||..:.|       |..||.
  Fly   187 FEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEI 251

  Fly   222 AE-----------------------EGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLE 263
            .|                       :.....|.||:.||.|   ..|..:.|  .||....:|.:
  Fly   252 TELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYIC---IGGMPVLT--SCPKGLFWDQK 311

  Fly   264 RKLCRPRSEVDCF 276
            ...|.....|.||
  Fly   312 SGFCEMEKNVKCF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 3/8 (38%)
CBM_14 150..197 CDD:279884 13/51 (25%)
CBM_14 221..275 CDD:279884 14/76 (18%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 13/46 (28%)
CBM_14 272..321 CDD:279884 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.