DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG10140

DIOPT Version :10

Sequence 1:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:236 Identity:51/236 - (21%)
Similarity:68/236 - (28%) Gaps:85/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DNVFGVFKSYPGGGFPVRFDYNNRCSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASS 130
            ||||              ..:...|:|              ||:|:....|..:|.....|||::
  Fly    60 DNVF--------------LPFVGDCNR--------------YYLCRSGQAIELQCEWPYEFNANT 96

  Fly   131 GRCVQHVPQHRPDHRPPQCQKEGRFPHPHDCKVYYRCDK--------NRTQPWLFACPAGTIFSP 187
            ..||                      ||.|......|:.        .||......|..|   .|
  Fly    97 QSCV----------------------HPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYG---KP 136

  Fly   188 VERKCLPGDQCPS-TEISDSGSYIPQNCELKFPECAEEGT------FRSPTDCALYYTCRLQESG 245
            |.|:|..|.|..| |:..|    .|||.:....||:....      ..|...|..|:.|     |
  Fly   137 VLRQCQDGLQYNSATDRCD----FPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFIC-----G 192

  Fly   246 TYLQTRFKCPGSNSFDLERKLCRPRSEVDCFDFVPGPVQVP 286
            ..:.....|.....|..:...|...|:.||        |:|
  Fly   193 NGIPREQTCTAGLHFSTKCDCCDIPSKSDC--------QIP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696 12/47 (26%)
CBM_14 150..197 CDD:426342 13/54 (24%)
CBM_14 221..275 CDD:426342 10/59 (17%)
CG10140NP_648648.2 CBM_14 63..106 CDD:426342 16/92 (17%)
CBM_14 111..161 CDD:426342 17/56 (30%)
CBM_14 178..222 CDD:426342 9/48 (19%)
ChtBD2 244..292 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.