DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG10725

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:81/246 - (32%) Gaps:92/246 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CSRNYIGIK----PHPDQQQYYY-----VCKP----DCVIFSKCRGLESF--------------- 126
            ||:.::.:.    |......||:     .|.|    :|:...|.|||.||               
  Fly    42 CSKYFLCMNEIAVPRECPTDYYFDARDQECVPLMEVECIGSCKNRGLSSFCYDRTCTKYVLCFDG 106

  Fly   127 -------------NASSGRCVQHVPQHRPDHRPPQCQKEGRFPHPHDCKVYY----RCDKNRTQP 174
                         ||.:.||  ..||: .|.....|.:..   :|.|. |:.    ||||     
  Fly   107 TPVIRQCSDGLQYNALTDRC--DYPQY-VDC
VDNLCSRNN---NPDDI-VFIPSKARCDK----- 159

  Fly   175 WLFACPAGTIFSPVERKCLPGDQC-PSTEISDSGSYIPQNCELK------FP-----------EC 221
             .:.|..|.   |..:.|..|.|. |||:..|..|.:  ||.::      .|           ||
  Fly   160 -YYICMDGL---PQVQNCTSGLQYNPSTQSCDFPSKV
--NCTVESLQRNILPFARAPPRLADIEC 218

  Fly   222 AEEG----TFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLCR 268
            ..||    ..:...|.  ||.| |...|..|.    |.....||.:|:.||
  Fly   219 PSEGAHFIAHQKRQDA--YYYC-LNGRGVTLD----CTPGLVFDAKREECR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 18/86 (21%)
CBM_14 150..197 CDD:279884 12/50 (24%)
CBM_14 221..275 CDD:279884 16/52 (31%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 6/30 (20%)
CBM_14 83..134 CDD:279884 12/53 (23%)
CBM_14 150..192 CDD:279884 15/50 (30%)
ChtBD2 216..264 CDD:214696 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.