DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and obst-G

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:230 Identity:46/230 - (20%)
Similarity:65/230 - (28%) Gaps:65/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGRC----------------VQHVP 138
            |.....|:.|.....:.||||.....:...|.....||..:..|                |....
  Fly    32 CEGKNGGLLPMFGSCKGYYVCADGNAVTGTCEKNTLFNPLTLHCDDPDNVDCIFDGKDNIVDDTS 96

  Fly   139 QHRPDH---------RPPQCQKEGRFPHP-------------------HDCKVYYRCDKNRTQPW 175
            ....|.         .||...|..:.|.|                   ..|:.||.|...:  |.
  Fly    97 SSESDEDDDEEMAKTDPPVTVKATKKPRPTTLDKMCAGKKDGVMLTKNGSCQEYYVCKAKK--PH 159

  Fly   176 LFACPAGTIFSPVERKCLPGDQCPSTEISDSGSYIPQNCELKFPE-----CAEE---GTFRSPTD 232
            |.:||....|||..|.|:     .::|...||. ..:|.|...|.     |::|   ......:|
  Fly   160 LRSCPDKQHFSPTRRICM-----KASEAKCSGG-TRENKESDGPATTGGVCSDEKENSLVAHRSD 218

  Fly   233 CALYYTCRLQESGTYLQTRFKCPGSNSFDLERKLC 267
            |..:..|     ...:.....||....|::....|
  Fly   219 CGKFMLC-----SNMMFLVMDCPTGLHFNIATSRC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 12/61 (20%)
CBM_14 150..197 CDD:279884 16/65 (25%)
CBM_14 221..275 CDD:279884 9/50 (18%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 11/50 (22%)
CBM_14 132..184 CDD:279884 14/58 (24%)
CBM_14 204..256 CDD:279884 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.