DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG5883

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:203 Identity:39/203 - (19%)
Similarity:61/203 - (30%) Gaps:90/203 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GFPVRFDYNNRCSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGRCVQHVPQHRPD 143
            |.|.|.|.|  |.:              ||.|....::.:.|.....:|.::|.||:        
  Fly   160 GTPFRDDAN--CHK--------------YYTCSSKSLVENTCENGLYYNVATGTCVR-------- 200

  Fly   144 HRPPQCQKEGRFPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQCPSTEISDSGS 208
            .:...|:.     ||                                  ||.:.|.:.:::....
  Fly   201 KKDVICEN-----HP----------------------------------LPDEVCGNKKLAVRNK 226

  Fly   209 YIPQNCELKFPECAEEGTFRSPTDCALYYTCRLQESG------TYLQTRFKCPGSNSFDLERKLC 267
            ::           ::..|      |..||.||...||      .|.|    |..:|.|:.||:.|
  Fly   227 FV-----------SDMAT------CRGYYYCRDLGSGIPDTDPIYQQ----CDENNFFNQERQAC 270

  Fly   268 RPRSEVDC 275
            .||....|
  Fly   271 MPRESQKC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 9/47 (19%)
CBM_14 150..197 CDD:279884 4/46 (9%)
CBM_14 221..275 CDD:279884 18/59 (31%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884
CBM_14 154..204 CDD:279884 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.