DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur2B and CG5897

DIOPT Version :9

Sequence 1:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:365 Identity:80/365 - (21%)
Similarity:117/365 - (32%) Gaps:116/365 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TGYYGQPPYAYPPYGYGYQAPPPVYQPYYDNVF--------GVFKSYPGGGFPVRFD--YNNRCS 91
            |||.|.|...   ..:||         ..||..        |:..|:..|......|  .:::.|
  Fly    35 TGYIGDPSDC---QAWGY---------CQDNKLIDRRSCTEGLLYSFRDGTCKRASDTICHSQLS 87

  Fly    92 RNYIGIKPHPDQQQYYYVCKP-DCVIFSKCRGLES-----------FNASSGRCVQHV---PQHR 141
            .....::|      :.||..| ||..|.||..|:.           |:.....|::.|   ||..
  Fly    88 EICASLEP------WNYVANPADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTCLEEVAGCPQDN 146

  Fly   142 PDHRPPQC--QKEGRF-PHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERK-----------C 192
                  .|  .|:|.| ..|..|::||:|......  :..|..|..|:   ||           |
  Fly   147 ------ICSHMKDGSFVGDPKSCQIYYKCHNGFGT--MLNCSVGRYFN---RKTGNCQSWMPHYC 200

  Fly   193 LPGDQ-----CPSTEISDSGSYIPQNCELKFPECAEEGTFRSP--TDCALYYTCRLQ-ESGTYLQ 249
            ...|:     .|||:         .|...|:.:...:|....|  ..|..||:|..| :.|.:  
  Fly   201 SKDDEDNILTPPSTD---------HNICSKYYQRDRDGVQLLPDLMTCYGYYSCTSQFDVGKW-- 254

  Fly   250 TRFKCPGSNSFDLERKLCRPRSEVDC-FDFVPGPVQVPYAPQPYYPPYPAAPPLYEEDDYDTGAR 313
              ..||....|:...:.|....:..| :|......|:..|                  ..:||.|
  Fly   255 --SSCPWGLHFEWWSQRCGSPKDNSCSYDRCANRNQLMVA------------------TINTGCR 299

  Fly   314 E----QQPALKSEKLQVAAEGFEKPSLNVVVLQTTTLEPS 349
            |    |....||.  |...|.:  |..|.::.|.|...|:
  Fly   300 EFTICQDNRSKSS--QKCPEDY--PYFNELLRQCTDEYPN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 13/59 (22%)
CBM_14 150..197 CDD:279884 14/58 (24%)
CBM_14 221..275 CDD:279884 12/56 (21%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.